As deepthi is an ips officer, i always knew that the last episode would. Kailasanathan episode 419 31052014 may 31, 2014 kailasanathan is a teleserial based on legends of hindu god shiva. Parasparam serial last episode climax parasparam deepthi bomb blast scene parasparam last episode troll video parasparam end scene asianet serial parasparam last episode. Parasparam malayalam television mega serial online asianet. Episode 344 180914 deepthi is an independent and bright young girl who dreams of becoming an honest ias officer with support from her parents. O99161 93212 indian free sex girls call monica friendship call me. Asianet, mazhavil manorama, malayalam youtube, tv shows episode. Strapon fucking my boy please comment big black cock fucks white b0y. Parasparam serial latest episodes on hotstar application. Meenakshis mother visits padipura house and taunts padmavathy. Gayathri bagged the most popular actress award during the recently held asianet television awards 2016. Portrays a of role deepthi the in airing parasparam ontv. The serial begins with the story of lord shiva and sati, who is considered as the amshavtharpartial incarnation of the.
Parasparam 29 june 2015 to 4 july 2015 complete episodes. I mean i never expected i will like the mal version of it, but lo i thoroughly enjoyed the episode. Mazhavil manorama malayalam serial ponnambili 18 july 2016 episode, ponnambili 19 july 2016 episode, ponnambili 20 july 2016 episode, ponnambili 21 july 2016 episode, ponnambili 22 july 2016 episode episode online. While everyone present were eagerly waiting for their deepthi ips and sooraj, essayed by gayathri arun and vivek gopan, the lead characters. Ripped denim saree at veere di wedding promotions filmibeat. Parasparam that airs on asianet, is one of the most popular serials in malayalam and is nearing its 900th episode. Asianet serials parasparamkailasanathanswayamvaram. Gayathri arun serial actress fucking free sex videos. Parasparam serial last episode climaxparasparam deepthi bomb blast scene parasparam last episode troll video.
Parasparam 18 december 2017 to 23 december 2017 complete. On insistence from his parents and spouse sandhya, gopan accepts the truth that deepthi will pursue her ambitions. In the turn of events the girl sooraj is to marry elopes leaving padmavathi very angry at the wedding hall. Gayathri arun newsolive gayathri arun is one of the most loved onscreen tiny surface actors for her duty deepthi ips. Her brother gopan is tired of her dreams and desires to wed her into a good family. Shared video is a sequence between sneha and sreekumar of an old episode of the. Asianet parasparam serial actress gayathri arun fake whatsapp video,parasparam serial actress gayathri arun latest beautiful photos. Comedy super nite s2 ep223 ambika pillai part02 full episode hd. There was the other sequence when the lead couples deepthi ips. Its the top rated television serial now in malayalam television channels. Why doesnt padmvathy want deepthi to become an ips officer. Parasparam 1917 parasparam 01 september 2017 episode.
Deepthi ips rip parasparam serial troll parasparam last episode. Dileeps mother drops in to announce that the wedding has to be postponed since he has been offered a job in america. Asianet tv serial parasparam episode 362 9102014 asianet serial parasparam 91014 deepthi is an independent and bright young girl who dreams of becoming an honest ias officer with support from her parents. Parasparam 010917, asianet tv serial parasparam 2017 september 1 episode no 1245, parasparam sep 09 watch online. The serial is mainly based on puranas and other epicbased works of mythologist devdutt pattanaik. Watch malayalam tv channel programmes, tele vision serials,chat talk shows online at. Parasparam is a 1983 indian malayalamlanguage film, directed by shajiyem and produced by jose brothers. Obviously youre going to totally, utterly bring it on the wedding episode. Malayalam serial parasparam actress deepthi fucking vedios. Parasparam is a malayalmcommercial serial in asianet the beginning of serial i also a viewer of this serial. The central character of serial parasparam is deepthi. On seeing deepti upset, padmavathi consoles her and reminds her that she and her husband will be there for her. Parasparam watch episode 33 the wedding plans change.
Deepthi ips rip parasparam serial troll parasparam last. The film also has happy weddingfame anu sithara in a key role. Watch parasparam malayalam family tv series on hotstar premium now. After they reach home, they see the entire house flooded.
Deepthi is an independent and bright young girl who dreams of becoming an honest ias officer with support from her parents. Parasparam 6 july 2015 to 11 july 2015 complete episodes. Parasparam watch episode 23 deepti marries suraj on. Vivek gopan and gayathri arun parasparam serial actress and actor. Parasparam story revolves around the struggles of deepthi, a civil service aspirant. Gayathri arun aka deepthi ips of parasparam to debut in. Is it the beauty of the story that makes every version of it beautiful. Padmavathy feels depressed as deepthi s arrival for the wedding gets doubtful.
Parasparam watch episode 17 deepthi saves the marriage. Asianet tv serial parasparam episode 369 17102014 asianet serial parasparam 171014 deepthi is an independent and bright young girl who dreams of becoming an honest ias officer with support from her parents. Parasparam 9316 parasparam 09 march 2016 episode 794. Mohena singh kumari on life after marriage, missing her yeh rishta. Gayathri arun aka deepthi ips of parasparam serial makes silver screen debut. This week serial is telecasting from episode 476 to 481.
Watch parasparam tv serial 08 04 2016 parasparam april 8,2016 parasparam 0842016 hotstar malayalam tv serial parasparam 0842016 youtube watch parasparam last episode 08th april 2016 online asianet tv serial parasparam today parasparam lateset episode parasparam epi 820. Parasparam serial is a remake of popular start plus serial diya aur baati hum. Parasparam serial actress gayathri arun wedding photos 12. Deepthi is a home based and bright young girl who ambitions of becoming a truthful ias officer with help from her mother and father. Parasparam 29 june 2015 to 4 july 2015 complete episodes hotstar video asianet parasparam serial 29062015 to 4072015 youtube videos admin 19. Parasparam 090316, asianet tv serial parasparam 2016 march 9 episode no 794, parasparam mar 03 watch online. Sneha posted a video on facebook following the news of her marriage. Sooraj is the apple of his mothers eye and the breadwinner of his family. Parasparam 6 july 2015 to 11 july 2015 complete episodes hotstar video asianet parasparam serial 6072015 to 11072015 youtube videos admin 00.
Parasparam 18 december 2017 to 23 december 2017 complete episodes 33 to 38 asianet parasparam serial 18122017 to 23122017 youtube hotstar videos admin 10. Mallu actress rekha fucking with her costar indian mallu actress shobha fucking. Meanwhile, sooraj is busy arranging the money for the wedding expenses. Though deepthi is angry at gopans decision, she gives in, on getting to know that her sisterinlaw is pregnant and is refusing to accompany gopan because she feels responsible for deepthi. Parasparam 8 april 2016 8 4 16 asianet tv serial episode 820 online. Its the malayalam remake of the hindi serial diya aur baati hum. Episode 3 120814 deepthi is an independent and bright young girl who dreams of becoming an honest ias officer with support from her. Parasparam 8 april 2016 8 4 16 asianet tv serial episode. This week serial is telecasting from episode 419 to 424. Krishnan advices sooraj to focus on the marriage preparations rather than being depressed thinking about deepthi. Sooraj warns deepthi to not eat or drink anything padmavati offers her, but deepthi pays no heed to his advice. Asianet serial parasparam is a superhit serial telecasting from monday to saturday at 9. Vivek gopan and gayathri arun parasparam serial actress.
Explore parasparam serial profile at times of india for photos, videos and latest news of parasparam serial. Parasparam aired its last episode on august 31 and social media went. Finally, padmavathi and her family welcome deepti home. Gayathri arun aka deepthi ips of parasparam serial makes silver. Asianet tv serial parasparam episode 439 08012015 asianet serial parasparam 08012015 deepthi is an independent and bright young girl who dreams of becoming an honest ias officer with support from her parents. Asianet showing parasparam serial on every monday to saturday at 9. Deepthi convinces dileeps mother to go ahead with the wedding in spite of suchitras failure in the exam. Naagin 3 serial online 11082018 colors hindi tv naagin 3 hindi serial online 100818 naagin. Goodbye parasparam, the malayalam serial that spawned a million.
Aarum ingne trollalle parasparam deepthi live gayathri. Shooting location paraspparam latest episode parasparam is ruling asianet channel since its beginning in the year 20. Parasparam serial latest episodes from 23rd february to. As deepthi is an ips officer, i always knew that the last episode would have something dramatic or heroic and was prepared for anything.
246 251 1007 905 1273 445 1284 1042 233 1266 322 824 484 862 789 838 987 1109 102 216 194 787 600 792 113 263 1484 276 117 663 309 829 36 1459 1202 1204 1370 392 450 565